Lineage for d1dvpa2 (1dvp A:149-220)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524678Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 524679Superfamily g.50.1: FYVE/PHD zinc finger [57903] (2 families) (S)
  5. 524680Family g.50.1.1: FYVE, a phosphatidylinositol-3-phosphate binding domain [57904] (4 proteins)
  6. 524690Protein Hrs [57907] (1 species)
    protein involved in membrane trafficking and signal transduction
  7. 524691Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57908] (1 PDB entry)
  8. 524692Domain d1dvpa2: 1dvp A:149-220 [45358]
    Other proteins in same PDB: d1dvpa1

Details for d1dvpa2

PDB Entry: 1dvp (more details), 2 Å

PDB Description: crystal structure of the vhs and fyve tandem domains of hrs, a protein involved in membrane trafficking and signal transduction

SCOP Domain Sequences for d1dvpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster)}
mftadtapnwadgrvchrcrveftftnrkhhcrncgqvfcgqctakqcplpkygiekevr
vcdgcfaalqrg

SCOP Domain Coordinates for d1dvpa2:

Click to download the PDB-style file with coordinates for d1dvpa2.
(The format of our PDB-style files is described here.)

Timeline for d1dvpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dvpa1