Lineage for d1tbna_ (1tbn A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642488Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 2642489Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 2642490Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
    Pfam PF00130
  6. 2642505Protein Protein kinase c-gamma [57895] (1 species)
  7. 2642506Species Rat (Rattus rattus) [TaxId:10117] [57896] (2 PDB entries)
  8. 2642507Domain d1tbna_: 1tbn A: [45354]
    complexed with zn

Details for d1tbna_

PDB Entry: 1tbn (more details)

PDB Description: nmr structure of a protein kinase c-g phorbol-binding domain, minimized average structure
PDB Compounds: (A:) protein kinase c, gamma type

SCOPe Domain Sequences for d1tbna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]}
qtddprnkhkfrlhsyssptfcdhcgsllyglvhqgmkcsccemnvhrrcvrsvpslcgv
dhterr

SCOPe Domain Coordinates for d1tbna_:

Click to download the PDB-style file with coordinates for d1tbna_.
(The format of our PDB-style files is described here.)

Timeline for d1tbna_: