SCOPe 2.03: Domain d1tbna_: 1tbn A:

Lineage for d1tbna_ (1tbn A:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.49.1: Cysteine-rich domain [57889] (3 families)

5. Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
   Pfam PF00130

6. Protein Protein kinase c-gamma [57895] (1 species)

7. Species Rat (Rattus rattus) [TaxId:10117] [57896] (2 PDB entries)

8. Domain d1tbna_: 1tbn A: [45354]
   complexed with zn

Details for d1tbna_

PDB Entry: 1tbn

PDB Description: nmr structure of a protein kinase c-g phorbol-binding domain, minimized average structure

PDB Compounds: (A:) protein kinase c, gamma type

SCOPe Domain Sequences for d1tbna_:

Sequence; same for both SEQRES and ATOM records:

>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]}
qtddprnkhkfrlhsyssptfcdhcgsllyglvhqgmkcsccemnvhrrcvrsvpslcgv
dhterr

Timeline for d1tbna_:

• d1tbna_ first appeared (with stable ids) in SCOP 1.55, called d1tbn__
  
• d1tbna_ appears in SCOPe 2.02
  
• d1tbna_ appears in SCOPe 2.04
  
• d1tbna_ appears in the current release, SCOPe 2.08