Lineage for d1tbn__ (1tbn -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41801Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
  4. 41802Superfamily g.49.1: Cysteine-rich domain [57889] (2 families) (S)
  5. 41803Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (4 proteins)
  6. 41811Protein Protein kinase c-gamma [57895] (1 species)
  7. 41812Species Rat (Rattus rattus) [TaxId:10117] [57896] (2 PDB entries)
  8. 41814Domain d1tbn__: 1tbn - [45354]

Details for d1tbn__

PDB Entry: 1tbn (more details)

PDB Description: nmr structure of a protein kinase c-g phorbol-binding domain, minimized average structure

SCOP Domain Sequences for d1tbn__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbn__ g.49.1.1 (-) Protein kinase c-gamma {Rat (Rattus rattus)}
qtddprnkhkfrlhsyssptfcdhcgsllyglvhqgmkcsccemnvhrrcvrsvpslcgv
dhterr

SCOP Domain Coordinates for d1tbn__:

Click to download the PDB-style file with coordinates for d1tbn__.
(The format of our PDB-style files is described here.)

Timeline for d1tbn__: