Class g: Small proteins [56992] (94 folds) |
Fold g.49: Cysteine-rich domain [57888] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) |
Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins) Pfam PF00130 |
Protein Protein kinase c-gamma [57895] (1 species) |
Species Rat (Rattus rattus) [TaxId:10117] [57896] (2 PDB entries) |
Domain d1tboa_: 1tbo A: [45353] complexed with zn |
PDB Entry: 1tbo (more details)
SCOPe Domain Sequences for d1tboa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tboa_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} qtddprnkhkfrlhsyssptfcdhcgsllyglvhqgmkcsccemnvhrrcvrsvpslcgv dhterr
Timeline for d1tboa_: