Lineage for d1faqa_ (1faq A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642488Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 2642489Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 2642490Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
    Pfam PF00130
  6. 2642509Protein RAF-1 [57893] (1 species)
  7. 2642510Species Human (Homo sapiens) [TaxId:9606] [57894] (2 PDB entries)
  8. 2642511Domain d1faqa_: 1faq A: [45352]
    complexed with zn

Details for d1faqa_

PDB Entry: 1faq (more details)

PDB Description: raf-1 cysteine rich domain, nmr, 27 structures
PDB Compounds: (A:) raf-1

SCOPe Domain Sequences for d1faqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]}
ltthnfarktflklafcdicqkfllngfrcqtcgykfhehcstkvptmcvdw

SCOPe Domain Coordinates for d1faqa_:

Click to download the PDB-style file with coordinates for d1faqa_.
(The format of our PDB-style files is described here.)

Timeline for d1faqa_: