Class g: Small proteins [56992] (94 folds) |
Fold g.49: Cysteine-rich domain [57888] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) |
Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins) Pfam PF00130 |
Protein RAF-1 [57893] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57894] (2 PDB entries) |
Domain d1faqa_: 1faq A: [45352] complexed with zn |
PDB Entry: 1faq (more details)
SCOPe Domain Sequences for d1faqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} ltthnfarktflklafcdicqkfllngfrcqtcgykfhehcstkvptmcvdw
Timeline for d1faqa_: