Lineage for d1far__ (1far -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41801Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
  4. 41802Superfamily g.49.1: Cysteine-rich domain [57889] (2 families) (S)
  5. 41803Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (4 proteins)
  6. 41815Protein RAF-1 [57893] (1 species)
  7. 41816Species Human (Homo sapiens) [TaxId:9606] [57894] (2 PDB entries)
  8. 41818Domain d1far__: 1far - [45351]

Details for d1far__

PDB Entry: 1far (more details)

PDB Description: raf-1 cysteine rich domain, nmr, minimized average structure

SCOP Domain Sequences for d1far__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1far__ g.49.1.1 (-) RAF-1 {Human (Homo sapiens)}
ltthnfarktflklafcdicqkfllngfrcqtcgykfhehcstkvptmcvdw

SCOP Domain Coordinates for d1far__:

Click to download the PDB-style file with coordinates for d1far__.
(The format of our PDB-style files is described here.)

Timeline for d1far__: