Lineage for d1fara_ (1far A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037801Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037802Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 3037803Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
    Pfam PF00130
  6. 3037822Protein RAF-1 [57893] (1 species)
  7. 3037823Species Human (Homo sapiens) [TaxId:9606] [57894] (2 PDB entries)
  8. 3037825Domain d1fara_: 1far A: [45351]
    complexed with zn

Details for d1fara_

PDB Entry: 1far (more details)

PDB Description: raf-1 cysteine rich domain, nmr, minimized average structure
PDB Compounds: (A:) raf-1

SCOPe Domain Sequences for d1fara_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fara_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]}
ltthnfarktflklafcdicqkfllngfrcqtcgykfhehcstkvptmcvdw

SCOPe Domain Coordinates for d1fara_:

Click to download the PDB-style file with coordinates for d1fara_.
(The format of our PDB-style files is described here.)

Timeline for d1fara_: