Lineage for d1co4a_ (1co4 A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.47: Zinc domain conserved in yeast copper-regulated transcription factors [57878] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. Superfamily g.47.1: Zinc domain conserved in yeast copper-regulated transcription factors [57879] (1 family) (S)
    automatically mapped to Pfam PF00649
  5. Family g.47.1.1: Zinc domain conserved in yeast copper-regulated transcription factors [57880] (1 protein)
  6. Protein Zinc domain conserved in yeast copper-regulated transcription factors [57881] (1 species)
  7. Species Synthetic [57882] (1 PDB entry)
  8. Domain d1co4a_: 1co4 A: [45347]
    complexed with zn

Details for d1co4a_

PDB Entry: 1co4 (more details)

PDB Description: solution structure of a zinc domain conserved in yeast copper-regulated transcription factors
PDB Compounds: (A:) protein (activator of metallothionein 1)

SCOPe Domain Sequences for d1co4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1co4a_ g.47.1.1 (A:) Zinc domain conserved in yeast copper-regulated transcription factors {Synthetic}
mvvingvkyacdscikshkaaqcehndrplkilkprgrpptt

SCOPe Domain Coordinates for d1co4a_ are not available.

Timeline for d1co4a_: