Class g: Small proteins [56992] (94 folds) |
Fold g.46: Metallothionein [57867] (1 superfamily) metal(iron)-bound fold duplication: consists of clear structural/sequence repeats |
Superfamily g.46.1: Metallothionein [57868] (1 family) |
Family g.46.1.1: Metallothionein [57869] (2 proteins) |
Protein Metallothionein [57870] (10 species) |
Species Rat (Rattus rattus) [TaxId:10117] [57873] (3 PDB entries) |
Domain d4mt2a_: 4mt2 A: [45331] Two domains (1-32;33-61) complexed with cd, na, zn |
PDB Entry: 4mt2 (more details), 2 Å
SCOPe Domain Sequences for d4mt2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mt2a_ g.46.1.1 (A:) Metallothionein {Rat (Rattus rattus) [TaxId: 10117]} mdpncscatdgscscagsckckqckctsckksccsccpvgcakcsqgcickeasdkcscc a
Timeline for d4mt2a_: