SCOPe 2.02: Domain d1dcqa2: 1dcq A:247-368

Lineage for d1dcqa2 (1dcq A:247-368)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.45: ArfGap/RecO-like zinc finger [57862] (1 superfamily)
   zinc-bound alpha+beta motif

4. Superfamily g.45.1: ArfGap/RecO-like zinc finger [57863] (2 families)

5. Family g.45.1.1: Pyk2-associated protein beta ARF-GAP domain [57864] (1 protein)

6. Protein Pyk2-associated protein beta ARF-GAP domain [57865] (1 species)
   core is similar to that of the RING finger but lacks one zinc-binding site

7. Species Mouse (Mus musculus) [TaxId:10090] [57866] (1 PDB entry)

8. Domain d1dcqa2: 1dcq A:247-368 [45326]
   Other proteins in same PDB: d1dcqa1
   complexed with zn

Details for d1dcqa2

PDB Entry: 1dcq, 2.1 Å

PDB Description: crystal structure of the arf-gap domain and ankyrin repeats of papbeta.

PDB Compounds: (A:) pyk2-associated protein beta

SCOPe Domain Sequences for d1dcqa2:

Sequence; same for both SEQRES and ATOM records:

>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]}
ltkeiisevqrmtgndvccdcgapdptwlstnlgiltciecsgihrelgvhysrmqsltl
dvlgtselllaknignagfneimecclpsedpvkpnpgsdmiarkdyitakymerryark
kh

Timeline for d1dcqa2:

• d1dcqa2 first appeared (with stable ids) in SCOP 1.55
  
• d1dcqa2 appears in SCOPe 2.01
  
• d1dcqa2 appears in SCOPe 2.03
  
• d1dcqa2 appears in the current release, SCOPe 2.08