SCOPe 2.05: Domain d1chca_: 1chc A:

Lineage for d1chca_ (1chc A:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)

6. Protein Immediate early protein, IEEHV [57856] (1 species)

7. Species Equine herpesvirus 1 [TaxId:10326] [57857] (1 PDB entry)

8. Domain d1chca_: 1chc A: [45323]
   complexed with zn

Details for d1chca_

PDB Entry: 1chc

PDB Description: structure of the c3hc4 domain by 1h-nuclear magnetic resonance spectroscopy; a new structural class of zinc-finger

PDB Compounds: (A:) equine herpes virus-1 ring domain

SCOPe Domain Sequences for d1chca_:

Sequence; same for both SEQRES and ATOM records:

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}
matvaercpicledpsnysmalpclhafcyvcitrwirqnptcplckvpvesvvhtiesd
sefgdqli

Timeline for d1chca_:

• d1chca_ first appeared (with stable ids) in SCOP 1.55, called d1chc__
  
• d1chca_ appears in SCOPe 2.04
  
• d1chca_ appears in SCOPe 2.06
  
• d1chca_ appears in the current release, SCOPe 2.08