SCOP 1.71: Domain d1chc__: 1chc -

Lineage for d1chc__ (1chc -)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (3 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins)

6. Protein Immediate early protein, IEEHV [57856] (1 species)

7. Species Equine herpes virus type 1 [57857] (1 PDB entry)

8. Domain d1chc__: 1chc - [45323]
   complexed with zn

Details for d1chc__

PDB Entry: 1chc

PDB Description: structure of the c3hc4 domain by 1h-nuclear magnetic resonance spectroscopy; a new structural class of zinc-finger

SCOP Domain Sequences for d1chc__:

Sequence; same for both SEQRES and ATOM records:

>d1chc__ g.44.1.1 (-) Immediate early protein, IEEHV {Equine herpes virus type 1}
matvaercpicledpsnysmalpclhafcyvcitrwirqnptcplckvpvesvvhtiesd
sefgdqli

Timeline for d1chc__:

• d1chc__ first appeared (with stable ids) in SCOP 1.55
  
• d1chc__ appears in SCOP 1.69
  
• d1chc__ is called d1chca_ in SCOP 1.73
  
• d1chc__ appears in the current release, SCOPe 2.08, called d1chca_