SCOPe 2.07: Domain d1fbva4: 1fbv A:356-434

Lineage for d1fbva4 (1fbv A:356-434)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)

6. Protein CBL [57852] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57853] (1 PDB entry)

8. Domain d1fbva4: 1fbv A:356-434 [45321]
   Other proteins in same PDB: d1fbva1, d1fbva2, d1fbva3, d1fbvc_
   complexed with so4, zn

Details for d1fbva4

PDB Entry: 1fbv, 2.9 Å

PDB Description: structure of a cbl-ubch7 complex: ring domain function in ubiquitin- protein ligases

PDB Compounds: (A:) signal transduction protein cbl

SCOPe Domain Sequences for d1fbva4:

Sequence; same for both SEQRES and ATOM records:

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}
tpqdhikvtqeqyelycemgstfqlckicaendkdvkiepcghlmctscltswqesegqg
cpfcrceikgtepivvdpf

Timeline for d1fbva4:

• d1fbva4 first appeared (with stable ids) in SCOP 1.55
  
• d1fbva4 appears in SCOPe 2.06
  
• d1fbva4 appears in the current release, SCOPe 2.08