Class g: Small proteins [56992] (90 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (6 families) |
Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins) |
Protein CBL [57852] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57853] (1 PDB entry) |
Domain d1fbva4: 1fbv A:356-434 [45321] Other proteins in same PDB: d1fbva1, d1fbva2, d1fbva3, d1fbvc_ complexed with so4, zn |
PDB Entry: 1fbv (more details), 2.9 Å
SCOP Domain Sequences for d1fbva4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} tpqdhikvtqeqyelycemgstfqlckicaendkdvkiepcghlmctscltswqesegqg cpfcrceikgtepivvdpf
Timeline for d1fbva4: