Lineage for d1fbva4 (1fbv A:356-434)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271595Fold g.44: RING finger domain, C3HC4 [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 271596Superfamily g.44.1: RING finger domain, C3HC4 [57850] (1 family) (S)
  5. 271597Family g.44.1.1: RING finger domain, C3HC4 [57851] (9 proteins)
  6. 271607Protein CBL [57852] (1 species)
  7. 271608Species Human (Homo sapiens) [TaxId:9606] [57853] (1 PDB entry)
  8. 271609Domain d1fbva4: 1fbv A:356-434 [45321]
    Other proteins in same PDB: d1fbva1, d1fbva2, d1fbva3, d1fbvc_
    complexed with so4, zn

Details for d1fbva4

PDB Entry: 1fbv (more details), 2.9 Å

PDB Description: structure of a cbl-ubch7 complex: ring domain function in ubiquitin- protein ligases

SCOP Domain Sequences for d1fbva4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens)}
tpqdhikvtqeqyelycemgstfqlckicaendkdvkiepcghlmctscltswqesegqg
cpfcrceikgtepivvdpf

SCOP Domain Coordinates for d1fbva4:

Click to download the PDB-style file with coordinates for d1fbva4.
(The format of our PDB-style files is described here.)

Timeline for d1fbva4: