Lineage for d1dgza_ (1dgz A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41721Fold g.42: Ribosomal protein L36 [57839] (1 superfamily)
  4. 41722Superfamily g.42.1: Ribosomal protein L36 [57840] (1 family) (S)
  5. 41723Family g.42.1.1: Ribosomal protein L36 [57841] (1 protein)
  6. 41724Protein Ribosomal protein L36 [57842] (1 species)
  7. 41725Species Thermus thermophilus [TaxId:274] [57843] (2 PDB entries)
  8. 41727Domain d1dgza_: 1dgz A: [45319]

Details for d1dgza_

PDB Entry: 1dgz (more details)

PDB Description: ribosmal protein l36 from thermus thermophilus: nmr structure ensemble
PDB Compounds: (A:) protein (l36 ribosomal protein)

SCOP Domain Sequences for d1dgza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgza_ g.42.1.1 (A:) Ribosomal protein L36 {Thermus thermophilus}
mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg

SCOP Domain Coordinates for d1dgza_:

Click to download the PDB-style file with coordinates for d1dgza_.
(The format of our PDB-style files is described here.)

Timeline for d1dgza_: