Lineage for d1ffkz_ (1ffk Z:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244855Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1245344Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1245449Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
  6. 1245450Protein Ribosomal protein L44e [57837] (1 species)
  7. 1245451Species Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
    Uniprot P32411
  8. 1245491Domain d1ffkz_: 1ffk Z: [45317]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_
    complexed with cd, k, mg

Details for d1ffkz_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
PDB Compounds: (Z:) ribosomal protein l44e

SCOPe Domain Sequences for d1ffkz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkz_ g.41.8.3 (Z:) Ribosomal protein L44e {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOPe Domain Coordinates for d1ffkz_:

Click to download the PDB-style file with coordinates for d1ffkz_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkz_: