![]() | Class g: Small proteins [56992] (79 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (14 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) ![]() |
![]() | Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein) |
![]() | Protein Ribosomal protein L44e [57837] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (19 PDB entries) |
![]() | Domain d1ffkz_: 1ffk Z: [45317] Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_ complexed with cd, k, mo3; mutant |
PDB Entry: 1ffk (more details), 2.4 Å
SCOP Domain Sequences for d1ffkz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffkz_ g.41.8.3 (Z:) Ribosomal protein L44e {Archaeon Haloarcula marismortui} mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk ptkktdlkyrcgecgkahlregwragrlefqe
Timeline for d1ffkz_: