Lineage for d1ffkw_ (1ffk W:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430156Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 430415Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) (S)
  5. 430416Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
  6. 430417Protein Ribosomal protein L37ae [57831] (1 species)
  7. 430418Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (18 PDB entries)
  8. 430422Domain d1ffkw_: 1ffk W: [45315]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkx_, d1ffkz_
    complexed with cd, k, mo3; mutant

Details for d1ffkw_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffkw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkw_ g.41.8.1 (W:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui}
ptgrfgpryglkirvrvrdveikhkkkykcpvcgfpklkrastsiwvcghcgykiaggay
tpetvagkavmka

SCOP Domain Coordinates for d1ffkw_:

Click to download the PDB-style file with coordinates for d1ffkw_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkw_: