![]() | Class g: Small proteins [56992] (66 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (12 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) ![]() |
![]() | Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein) |
![]() | Protein Ribosomal protein L37ae [57831] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (12 PDB entries) |
![]() | Domain d1ffkw_: 1ffk W: [45315] Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkx_, d1ffkz_ complexed with cd, k, mo3; mutant |
PDB Entry: 1ffk (more details), 2.4 Å
SCOP Domain Sequences for d1ffkw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffkw_ g.41.8.1 (W:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui} ptgrfgpryglkirvrvrdveikhkkkykcpvcgfpklkrastsiwvcghcgykiaggay tpetvagkavmka
Timeline for d1ffkw_: