Lineage for d2atcb2 (2atc B:101-152)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524121Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 524338Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 524339Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 524340Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)
  7. 524343Species Escherichia coli [TaxId:562] [57828] (33 PDB entries)
  8. 524415Domain d2atcb2: 2atc B:101-152 [45314]
    Other proteins in same PDB: d2atca1, d2atca2, d2atcb1

Details for d2atcb2

PDB Entry: 2atc (more details), 3 Å

PDB Description: crystal and molecular structures of native and ctp-liganded aspartate carbamoyltransferase from escherichia coli

SCOP Domain Sequences for d2atcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atcb2 g.41.7.1 (B:101-152) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
ernidvlvcpdsncishaepvsssfavrraddialkckycekefshnvvlan

SCOP Domain Coordinates for d2atcb2:

Click to download the PDB-style file with coordinates for d2atcb2.
(The format of our PDB-style files is described here.)

Timeline for d2atcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2atcb1