Lineage for d3at1d2 (3at1 D:101-153)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41508Fold g.41: Rubredoxin-like [57769] (8 superfamilies)
  4. 41656Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 41657Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 41658Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species)
  7. 41659Species Escherichia coli [TaxId:562] [57828] (25 PDB entries)
  8. 41703Domain d3at1d2: 3at1 D:101-153 [45311]
    Other proteins in same PDB: d3at1a1, d3at1a2, d3at1b1, d3at1c1, d3at1c2, d3at1d1

Details for d3at1d2

PDB Entry: 3at1 (more details), 2.8 Å

PDB Description: crystal structures of phosphonoacetamide ligated t and phosphonoacetamide and malonate ligated r states of aspartate carbamoyltransferase at 2.8-angstroms resolution and neutral ph

SCOP Domain Sequences for d3at1d2:

Sequence, based on SEQRES records: (download)

>d3at1d2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
erinnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Sequence, based on observed residues (ATOM records): (download)

>d3at1d2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d3at1d2:

Click to download the PDB-style file with coordinates for d3at1d2.
(The format of our PDB-style files is described here.)

Timeline for d3at1d2: