Lineage for d1acmd2 (1acm D:101-153)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41508Fold g.41: Rubredoxin-like [57769] (8 superfamilies)
  4. 41656Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 41657Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 41658Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species)
  7. 41659Species Escherichia coli [TaxId:562] [57828] (25 PDB entries)
  8. 41699Domain d1acmd2: 1acm D:101-153 [45308]
    Other proteins in same PDB: d1acma1, d1acma2, d1acmb1, d1acmc1, d1acmc2, d1acmd1

Details for d1acmd2

PDB Entry: 1acm (more details), 2.8 Å

PDB Description: arginine 54 in the active site of escherichia coli aspartate transcarbamoylase is critical for catalysis: a site-specific mutagenesis, nmr and x-ray crystallography study
PDB Compounds: (D:)

SCOP Domain Sequences for d1acmd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1acmd2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d1acmd2:

Click to download the PDB-style file with coordinates for d1acmd2.
(The format of our PDB-style files is described here.)

Timeline for d1acmd2: