Lineage for d2at1b2 (2at1 B:101-153)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624613Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 624863Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 624864Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 624865Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)
  7. 624868Species Escherichia coli [TaxId:562] [57828] (33 PDB entries)
  8. 624915Domain d2at1b2: 2at1 B:101-153 [45303]
    Other proteins in same PDB: d2at1a1, d2at1a2, d2at1b1, d2at1c1, d2at1c2, d2at1d1

Details for d2at1b2

PDB Entry: 2at1 (more details), 2.8 Å

PDB Description: crystal structures of phosphonoacetamide ligated t and phosphonoacetamide and malonate ligated r states of aspartate carbamoyltransferase at 2.8-angstroms resolution and neutral ph

SCOP Domain Sequences for d2at1b2:

Sequence, based on SEQRES records: (download)

>d2at1b2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
erinnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Sequence, based on observed residues (ATOM records): (download)

>d2at1b2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d2at1b2:

Click to download the PDB-style file with coordinates for d2at1b2.
(The format of our PDB-style files is described here.)

Timeline for d2at1b2: