Lineage for d8at1b2 (8at1 B:101-153)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430156Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 430359Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 430360Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 430361Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species)
  7. 430362Species Escherichia coli [TaxId:562] [57828] (27 PDB entries)
  8. 430399Domain d8at1b2: 8at1 B:101-153 [45299]
    Other proteins in same PDB: d8at1a1, d8at1a2, d8at1b1, d8at1c1, d8at1c2, d8at1d1

Details for d8at1b2

PDB Entry: 8at1 (more details), 2.8 Å

PDB Description: crystal structures of aspartate carbamoyltransferase ligated with phosphonoacetamide, malonate, and ctp or atp at 2.8-angstroms resolution and neutral p*h
PDB Compounds: (B:)

SCOP Domain Sequences for d8at1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d8at1b2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d8at1b2:

Click to download the PDB-style file with coordinates for d8at1b2.
(The format of our PDB-style files is described here.)

Timeline for d8at1b2: