Lineage for d1raeb2 (1rae B:101-153)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524121Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 524338Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 524339Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 524340Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)
  7. 524343Species Escherichia coli [TaxId:562] [57828] (33 PDB entries)
  8. 524376Domain d1raeb2: 1rae B:101-153 [45297]
    Other proteins in same PDB: d1raea1, d1raea2, d1raeb1, d1raec1, d1raec2, d1raed1

Details for d1raeb2

PDB Entry: 1rae (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1raeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1raeb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d1raeb2:

Click to download the PDB-style file with coordinates for d1raeb2.
(The format of our PDB-style files is described here.)

Timeline for d1raeb2: