Lineage for d1radb2 (1rad B:101-153)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41508Fold g.41: Rubredoxin-like [57769] (8 superfamilies)
  4. 41656Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 41657Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 41658Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species)
  7. 41659Species Escherichia coli [TaxId:562] [57828] (25 PDB entries)
  8. 41686Domain d1radb2: 1rad B:101-153 [45295]
    Other proteins in same PDB: d1rada1, d1rada2, d1radb1, d1radc1, d1radc2, d1radd1

Details for d1radb2

PDB Entry: 1rad (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1radb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1radb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d1radb2:

Click to download the PDB-style file with coordinates for d1radb2.
(The format of our PDB-style files is described here.)

Timeline for d1radb2: