SCOP 1.69: Domain d1raab2: 1raa B:101-153

Lineage for d1raab2 (1raa B:101-153)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family)

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)

7. Species Escherichia coli [TaxId:562] [57828] (33 PDB entries)

8. Domain d1raab2: 1raa B:101-153 [45285]
   Other proteins in same PDB: d1raaa1, d1raaa2, d1raab1, d1raac1, d1raac2, d1raad1

Details for d1raab2

PDB Entry: 1raa, 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1raab2:

Sequence; same for both SEQRES and ATOM records:

>d1raab2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d1raab2:

• d1raab2 first appeared (with stable ids) in SCOP 1.55
  
• d1raab2 appears in SCOP 1.67
  
• d1raab2 appears in SCOP 1.71
  
• d1raab2 appears in the current release, SCOPe 2.08