Lineage for d1raab2 (1raa B:101-153)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.41: Rubredoxin-like [57769] (9 superfamilies) 
Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) 
Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein) Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species) Species Escherichia coli [TaxId:562] [57828] (26 PDB entries) 
Domain d1raab2: 1raa B:101-153 [45285]
Other proteins in same PDB: d1raaa1, d1raaa2, d1raab1, d1raac1, d1raac2, d1raad1
Details for d1raab2
PDB Entry: 1raa (more details), 2.5 Å
PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity
SCOP Domain Sequences for d1raab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1raab2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan
SCOP Domain Coordinates for d1raab2:
Click to download the PDB-style file with coordinates for d1raab2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1raab2:
View in 3D
