Lineage for d8atcd2 (8atc D:101-153)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430156Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 430359Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 430360Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 430361Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species)
  7. 430362Species Escherichia coli [TaxId:562] [57828] (27 PDB entries)
  8. 430374Domain d8atcd2: 8atc D:101-153 [45280]
    Other proteins in same PDB: d8atcb1, d8atcd1
    complexed with pal, zn

Details for d8atcd2

PDB Entry: 8atc (more details), 2.5 Å

PDB Description: complex of n-phosphonacetyl-l-aspartate with aspartate carbamoyltransferase. x-ray refinement, analysis of conformational changes and catalytic and allosteric mechanisms
PDB Compounds: (D:)

SCOP Domain Sequences for d8atcd2:

Sequence, based on SEQRES records: (download)

>d8atcd2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
erinnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Sequence, based on observed residues (ATOM records): (download)

>d8atcd2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d8atcd2:

Click to download the PDB-style file with coordinates for d8atcd2.
(The format of our PDB-style files is described here.)

Timeline for d8atcd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d8atcd1