Lineage for d8atcb2 (8atc B:101-153)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2587937Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 2587938Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 2587939Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 2587940Species Escherichia coli [TaxId:562] [57828] (60 PDB entries)
    Uniprot P00478
  8. 2588023Domain d8atcb2: 8atc B:101-153 [45279]
    Other proteins in same PDB: d8atca1, d8atca2, d8atcb1, d8atcc1, d8atcc2, d8atcd1
    complexed with pal, zn

Details for d8atcb2

PDB Entry: 8atc (more details), 2.5 Å

PDB Description: complex of n-phosphonacetyl-l-aspartate with aspartate carbamoyltransferase. x-ray refinement, analysis of conformational changes and catalytic and allosteric mechanisms
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d8atcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d8atcb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d8atcb2:

Click to download the PDB-style file with coordinates for d8atcb2.
(The format of our PDB-style files is described here.)

Timeline for d8atcb2: