Lineage for d1ragd2 (1rag D:101-153)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2587937Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 2587938Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 2587939Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 2587940Species Escherichia coli [TaxId:562] [57828] (60 PDB entries)
    Uniprot P00478
  8. 2588030Domain d1ragd2: 1rag D:101-153 [45278]
    Other proteins in same PDB: d1raga1, d1raga2, d1ragb1, d1ragc1, d1ragc2, d1ragd1
    complexed with ctp, zn; mutant

Details for d1ragd2

PDB Entry: 1rag (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1ragd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ragd2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d1ragd2:

Click to download the PDB-style file with coordinates for d1ragd2.
(The format of our PDB-style files is described here.)

Timeline for d1ragd2: