Lineage for d1ragb2 (1rag B:101-153)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893271Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 893272Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 893273Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)
  7. 893277Species Escherichia coli [TaxId:562] [57828] (46 PDB entries)
    Uniprot P00478
  8. 893320Domain d1ragb2: 1rag B:101-153 [45277]
    Other proteins in same PDB: d1raga1, d1raga2, d1ragb1, d1ragc1, d1ragc2, d1ragd1

Details for d1ragb2

PDB Entry: 1rag (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d1ragb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ragb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d1ragb2:

Click to download the PDB-style file with coordinates for d1ragb2.
(The format of our PDB-style files is described here.)

Timeline for d1ragb2: