SCOP 1.65: Domain d5at1b2: 5at1 B:101-153

Lineage for d5at1b2 (5at1 B:101-153)

Root: SCOP 1.65
Class g: Small proteins [56992] (66 folds)
Fold g.41: Rubredoxin-like [57769] (12 superfamilies)
metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family)
Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species)
Species Escherichia coli [TaxId:562] [57828] (26 PDB entries)
Domain d5at1b2: 5at1 B:101-153 [45273]
Other proteins in same PDB: d5at1a1, d5at1a2, d5at1b1, d5at1c1, d5at1c2, d5at1d1

Details for d5at1b2

PDB Entry: 5at1 (more details), 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution

SCOP Domain Sequences for d5at1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5at1b2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d5at1b2:

Click to download the PDB-style file with coordinates for d5at1b2.
(The format of our PDB-style files is described here.)

Timeline for d5at1b2: