Lineage for d1f1bb2 (1f1b B:101-153)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524121Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 524338Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 524339Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 524340Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)
  7. 524343Species Escherichia coli [TaxId:562] [57828] (33 PDB entries)
  8. 524344Domain d1f1bb2: 1f1b B:101-153 [45269]
    Other proteins in same PDB: d1f1ba1, d1f1ba2, d1f1bb1, d1f1bc1, d1f1bc2, d1f1bd1

Details for d1f1bb2

PDB Entry: 1f1b (more details), 2.3 Å

PDB Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the r-state in the presence of n-phosphonacetyl-l-aspartate

SCOP Domain Sequences for d1f1bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1bb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d1f1bb2:

Click to download the PDB-style file with coordinates for d1f1bb2.
(The format of our PDB-style files is described here.)

Timeline for d1f1bb2: