Lineage for d1ocof_ (1oco F:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893109Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 893235Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
    membrane-anchored rubredoxin-like domain
  6. 893236Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 893237Species Cow (Bos taurus) [TaxId:9913] [57820] (14 PDB entries)
  8. 893262Domain d1ocof_: 1oco F: [45264]
    Other proteins in same PDB: d1ocoa_, d1ocob1, d1ocob2, d1ococ_, d1ocod_, d1ocoe_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocor_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_

Details for d1ocof_

PDB Entry: 1oco (more details), 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state
PDB Compounds: (F:) cytochrome c oxidase

SCOP Domain Sequences for d1ocof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocof_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOP Domain Coordinates for d1ocof_:

Click to download the PDB-style file with coordinates for d1ocof_.
(The format of our PDB-style files is described here.)

Timeline for d1ocof_: