Lineage for d1oczs_ (1ocz S:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893109Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 893235Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
    membrane-anchored rubredoxin-like domain
  6. 893236Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 893237Species Cow (Bos taurus) [TaxId:9913] [57820] (14 PDB entries)
  8. 893265Domain d1oczs_: 1ocz S: [45263]
    Other proteins in same PDB: d1ocza_, d1oczb1, d1oczb2, d1oczc_, d1oczd_, d1ocze_, d1oczg_, d1oczh_, d1oczi_, d1oczj_, d1oczk_, d1oczl_, d1oczm_, d1oczn_, d1oczo1, d1oczo2, d1oczp_, d1oczq_, d1oczr_, d1oczt_, d1oczu_, d1oczv_, d1oczw_, d1oczx_, d1oczy_, d1oczz_
    complexed with azi, cu, hea, mg, na, zn

Details for d1oczs_

PDB Entry: 1ocz (more details), 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state
PDB Compounds: (S:) cytochrome c oxidase

SCOP Domain Sequences for d1oczs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oczs_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOP Domain Coordinates for d1oczs_:

Click to download the PDB-style file with coordinates for d1oczs_.
(The format of our PDB-style files is described here.)

Timeline for d1oczs_: