SCOPe 2.07: Domain d1dfxa2: 1dfx A:1-36

Lineage for d1dfxa2 (1dfx A:1-36)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
   automatically mapped to Pfam PF06397

6. Protein Desulfoferrodoxin N-terminal domain [57816] (2 species)

7. Species Desulfovibrio desulfuricans [TaxId:876] [57817] (1 PDB entry)

8. Domain d1dfxa2: 1dfx A:1-36 [45255]
   Other proteins in same PDB: d1dfxa1
   complexed with ca, fe

Details for d1dfxa2

PDB Entry: 1dfx, 1.9 Å

PDB Description: desulfoferrodoxin from desulfovibrio desulfuricans, atcc 27774

PDB Compounds: (A:) desulfoferrodoxin

SCOPe Domain Sequences for d1dfxa2:

Sequence; same for both SEQRES and ATOM records:

>d1dfxa2 g.41.5.2 (A:1-36) Desulfoferrodoxin N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]}
pkhlevykcthcgnivevlhgggaelvccgepmkhm

Timeline for d1dfxa2:

• d1dfxa2 first appeared (with stable ids) in SCOP 1.55, called d1dfx_2
  
• d1dfxa2 appears in SCOPe 2.06
  
• d1dfxa2 appears in the current release, SCOPe 2.08