![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
![]() | Family g.41.5.2: Desulforedoxin [57813] (2 proteins) automatically mapped to Pfam PF06397 |
![]() | Protein Desulfoferrodoxin N-terminal domain [57816] (2 species) |
![]() | Species Desulfovibrio desulfuricans [TaxId:876] [57817] (1 PDB entry) |
![]() | Domain d1dfxa2: 1dfx A:1-36 [45255] Other proteins in same PDB: d1dfxa1 complexed with ca, fe |
PDB Entry: 1dfx (more details), 1.9 Å
SCOPe Domain Sequences for d1dfxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dfxa2 g.41.5.2 (A:1-36) Desulfoferrodoxin N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} pkhlevykcthcgnivevlhgggaelvccgepmkhm
Timeline for d1dfxa2: