Lineage for d1dfxa2 (1dfx A:1-36)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066160Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 1066285Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
  6. 1066286Protein Desulfoferrodoxin N-terminal domain [57816] (2 species)
  7. 1066294Species Desulfovibrio desulfuricans [TaxId:876] [57817] (4 PDB entries)
  8. 1066303Domain d1dfxa2: 1dfx A:1-36 [45255]
    Other proteins in same PDB: d1dfxa1
    complexed with ca, fe

Details for d1dfxa2

PDB Entry: 1dfx (more details), 1.9 Å

PDB Description: desulfoferrodoxin from desulfovibrio desulfuricans, atcc 27774
PDB Compounds: (A:) desulfoferrodoxin

SCOPe Domain Sequences for d1dfxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfxa2 g.41.5.2 (A:1-36) Desulfoferrodoxin N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]}
pkhlevykcthcgnivevlhgggaelvccgepmkhm

SCOPe Domain Coordinates for d1dfxa2:

Click to download the PDB-style file with coordinates for d1dfxa2.
(The format of our PDB-style files is described here.)

Timeline for d1dfxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dfxa1