Lineage for d1dhga_ (1dhg A:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 344238Fold g.41: Rubredoxin-like [57769] (12 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 344326Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 344381Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
  6. 344385Protein Desulforedoxin [57814] (1 species)
    dimeric mono-domain protein with two rubredoxin-type metal centres
  7. 344386Species Desulfovibrio gigas [TaxId:879] [57815] (4 PDB entries)
  8. 344393Domain d1dhga_: 1dhg A: [45253]

Details for d1dhga_

PDB Entry: 1dhg (more details), 2.5 Å

PDB Description: hg-substituted desulforedoxin

SCOP Domain Sequences for d1dhga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dhga_ g.41.5.2 (A:) Desulforedoxin {Desulfovibrio gigas}
anegdvykcelcgqvvkvleegggtlvccgedmvkq

SCOP Domain Coordinates for d1dhga_:

Click to download the PDB-style file with coordinates for d1dhga_.
(The format of our PDB-style files is described here.)

Timeline for d1dhga_:

344393
d1dhga_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1dhgb_