SCOPe 2.08: Domain d1dhga_: 1dhg A:

Lineage for d1dhga_ (1dhg A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
   automatically mapped to Pfam PF06397

6. Protein Desulforedoxin [57814] (1 species)
   dimeric mono-domain protein with two rubredoxin-type metal centres

7. Species Desulfovibrio gigas [TaxId:879] [57815] (6 PDB entries)

8. Domain d1dhga_: 1dhg A: [45253]
   Hg-substituted
   complexed with hg

Details for d1dhga_

PDB Entry: 1dhg, 2.5 Å

PDB Description: hg-substituted desulforedoxin

PDB Compounds: (A:) protein (desulforedoxin)

SCOPe Domain Sequences for d1dhga_:

Sequence; same for both SEQRES and ATOM records:

>d1dhga_ g.41.5.2 (A:) Desulforedoxin {Desulfovibrio gigas [TaxId: 879]}
anegdvykcelcgqvvkvleegggtlvccgedmvkq

Timeline for d1dhga_:

• d1dhga_ first appeared (with stable ids) in SCOP 1.55
  
• d1dhga_ appears in SCOPe 2.07