Lineage for d1dcdb_ (1dcd B:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144883Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 144953Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 145001Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
  6. 145005Protein Desulforedoxin [57814] (1 species)
  7. 145006Species Desulfovibrio gigas [TaxId:879] [57815] (4 PDB entries)
  8. 145012Domain d1dcdb_: 1dcd B: [45252]

Details for d1dcdb_

PDB Entry: 1dcd (more details), 2 Å

PDB Description: desulforedoxin complexed with cd2+

SCOP Domain Sequences for d1dcdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dcdb_ g.41.5.2 (B:) Desulforedoxin {Desulfovibrio gigas}
anegdvykcelcgqvvkvleegggtlvccgedmvkq

SCOP Domain Coordinates for d1dcdb_:

Click to download the PDB-style file with coordinates for d1dcdb_.
(The format of our PDB-style files is described here.)

Timeline for d1dcdb_: