Class g: Small proteins [56992] (100 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) |
Family g.41.5.2: Desulforedoxin [57813] (2 proteins) automatically mapped to Pfam PF06397 |
Protein Desulforedoxin [57814] (1 species) dimeric mono-domain protein with two rubredoxin-type metal centres |
Species Desulfovibrio gigas [TaxId:879] [57815] (6 PDB entries) |
Domain d1dcdb_: 1dcd B: [45252] complexed with Cd2+ complexed with cd |
PDB Entry: 1dcd (more details), 2 Å
SCOPe Domain Sequences for d1dcdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dcdb_ g.41.5.2 (B:) Desulforedoxin {Desulfovibrio gigas [TaxId: 879]} anegdvykcelcgqvvkvleegggtlvccgedmvkq
Timeline for d1dcdb_: