Lineage for d1dcda_ (1dcd A:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90495Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 90565Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 90611Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
  6. 90615Protein Desulforedoxin [57814] (1 species)
  7. 90616Species Desulfovibrio gigas [TaxId:879] [57815] (4 PDB entries)
  8. 90621Domain d1dcda_: 1dcd A: [45251]

Details for d1dcda_

PDB Entry: 1dcd (more details), 2 Å

PDB Description: desulforedoxin complexed with cd2+

SCOP Domain Sequences for d1dcda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dcda_ g.41.5.2 (A:) Desulforedoxin {Desulfovibrio gigas}
anegdvykcelcgqvvkvleegggtlvccgedmvkq

SCOP Domain Coordinates for d1dcda_:

Click to download the PDB-style file with coordinates for d1dcda_.
(The format of our PDB-style files is described here.)

Timeline for d1dcda_: