Lineage for d1cfwb_ (1cfw B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641212Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2641359Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
    automatically mapped to Pfam PF06397
  6. 2641370Protein Desulforedoxin [57814] (1 species)
    dimeric mono-domain protein with two rubredoxin-type metal centres
  7. 2641371Species Desulfovibrio gigas [TaxId:879] [57815] (6 PDB entries)
  8. 2641375Domain d1cfwb_: 1cfw B: [45250]
    Ga-substituted
    complexed with ga, so4

Details for d1cfwb_

PDB Entry: 1cfw (more details), 1.9 Å

PDB Description: ga-substituted desulforedoxin
PDB Compounds: (B:) protein (desulforedoxin)

SCOPe Domain Sequences for d1cfwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfwb_ g.41.5.2 (B:) Desulforedoxin {Desulfovibrio gigas [TaxId: 879]}
anegdvykcelcgqvvkvleegggtlvccgedmvkq

SCOPe Domain Coordinates for d1cfwb_:

Click to download the PDB-style file with coordinates for d1cfwb_.
(The format of our PDB-style files is described here.)

Timeline for d1cfwb_: