SCOP 1.63: Domain d1cfwb_: 1cfw B:

Lineage for d1cfwb_ (1cfw B:)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.41: Rubredoxin-like [57769] (10 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families)

5. Family g.41.5.2: Desulforedoxin [57813] (2 proteins)

6. Protein Desulforedoxin [57814] (1 species)
   dimeric mono-domain protein with two rubredoxin-type metal centres

7. Species Desulfovibrio gigas [TaxId:879] [57815] (4 PDB entries)

8. Domain d1cfwb_: 1cfw B: [45250]
   Ga-substituted
   complexed with ga, so4

Details for d1cfwb_

PDB Entry: 1cfw, 1.9 Å

PDB Description: ga-substituted desulforedoxin

SCOP Domain Sequences for d1cfwb_:

Sequence; same for both SEQRES and ATOM records:

>d1cfwb_ g.41.5.2 (B:) Desulforedoxin {Desulfovibrio gigas}
anegdvykcelcgqvvkvleegggtlvccgedmvkq

Timeline for d1cfwb_:

• d1cfwb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cfwb_ appears in SCOP 1.61
  
• d1cfwb_ appears in SCOP 1.65
  
• d1cfwb_ appears in the current release, SCOPe 2.08