Lineage for d1cfwb_ (1cfw B:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204875Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 204959Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 205010Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
  6. 205014Protein Desulforedoxin [57814] (1 species)
  7. 205015Species Desulfovibrio gigas [TaxId:879] [57815] (4 PDB entries)
  8. 205019Domain d1cfwb_: 1cfw B: [45250]

Details for d1cfwb_

PDB Entry: 1cfw (more details), 1.9 Å

PDB Description: ga-substituted desulforedoxin

SCOP Domain Sequences for d1cfwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfwb_ g.41.5.2 (B:) Desulforedoxin {Desulfovibrio gigas}
anegdvykcelcgqvvkvleegggtlvccgedmvkq

SCOP Domain Coordinates for d1cfwb_:

Click to download the PDB-style file with coordinates for d1cfwb_.
(The format of our PDB-style files is described here.)

Timeline for d1cfwb_:

205019
d1cfwb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1cfwa_