Lineage for d1dxga_ (1dxg A:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144883Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 144953Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 145001Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
  6. 145005Protein Desulforedoxin [57814] (1 species)
  7. 145006Species Desulfovibrio gigas [TaxId:879] [57815] (4 PDB entries)
  8. 145007Domain d1dxga_: 1dxg A: [45247]

Details for d1dxga_

PDB Entry: 1dxg (more details), 1.8 Å

PDB Description: crystal structure of desulforedoxin from desulfovibrio gigas at 1.8 a resolution

SCOP Domain Sequences for d1dxga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxga_ g.41.5.2 (A:) Desulforedoxin {Desulfovibrio gigas}
anegdvykcelcgqvvkvleegggtlvccgedmvkq

SCOP Domain Coordinates for d1dxga_:

Click to download the PDB-style file with coordinates for d1dxga_.
(The format of our PDB-style files is described here.)

Timeline for d1dxga_: